TESA

Verified & analyzed by a 3rd Party US cGMP Testing Laboratory.

TESA

Price range: $55.00 through $85.00

Verified & analyzed by a 3rd Party US cGMP Testing Laboratory.

- +
Guaranteed Safe Checkout

TESAMORELIN is a next-generation premium research compound engineered for advanced analytical, laboratory applications and is commonly researched for:

  • Growth hormone–releasing hormone (GHRH) receptor signaling
  • Growth hormone and IGF-1 axis research
  • Visceral adipose-tissue/metabolic research
  • Lipid metabolism
  • Body-composition research
  • Glucose metabolism and insulin-sensitivity research
  • Growth hormone secretagogue/analogue research

Produced under tightly controlled conditions, each batch is precision-formulated and rigorously evaluated to ensure unmatched consistency, structural integrity, and premium performance. Each vial of TESAMORELIN is supplied as a lyophilized powder and is accompanied by a certificate of analysis verifying identity, purity, and composition. Manufactured under controlled standards to maintain consistency across laboratory research applications.

Technical Specifications

Chemical Name: Tesamorelin (TH9507), a stabilized synthetic analogue of growth hormone-releasing hormone (GHRH). 

CAS No.: 218949-48-5 

Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL — 44 amino acids. 

Molecular Formula: C₂₂₁H₃₆₆N₇₂O₆₇S 

Molecular Weight: 5,136 g/mol


Product Profile

Form: Lyophilized white to off-white powder
Fill: Refer to vial label
Purity: 99% + target specification
Testing: Independently third-party verified


Quality Standard

  • Exceeds 99% Purity: Analyzed via High-Performance Liquid Chromatography (HPLC) and Mass Spectrometry to ensure the removal of impurities and synthesis byproducts.
  • Verified Structural Integrity: Precise sequencing and analysis ensure the compound matches the exact chemical profile required for your research protocols.
  • Stable Formulation: Supplied as a lyophilized powder to ensure long-term stability and ease of reconstitution in laboratory solvents.
  • Quality Assurance Guarantee: Every batch undergoes rigorous testing. We prioritize transparency and trust, providing researchers with reliable compounds for their data collection.

Storage Protocol

• Store at 2–8°C for short-term stability
• Store at −20°C for long-term preservation
• Avoid repeated freeze–thaw cycles
• Handle in accordance with standard laboratory protocols


Research Use Only

This material is supplied strictly for research, education and laboratory use only.
Not for human or animal consumption.
Not intended to diagnose, treat, cure, or prevent any condition.
Not classified as a drug, food, cosmetic, or dietary product.

For use by qualified professionals in controlled research environments only. It has not been evaluated by the FDA and is not intended to diagnose, treat, cure, or prevent any disease. All buyers must be authorized research personnel or institutions.

Terms of Sale:
By purchasing this product, you confirm that you are a qualified professional conducting lawful scientific research. LYPHTIDE and its affiliates are not liable for any misuse or mishandling of this material. The buyer assumes all responsibility for ensuring proper handling, storage, and use in compliance with applicable laws and regulations. LYPHTIDE makes no representations or warranties regarding fitness for any purpose other than research. Product use is restricted to qualified researchers in compliance with local, state, and federal law.

Disclaimer
By purchasing from LYPHTIDE, the customer acknowledges and agrees this is strictly for research purposes only.

  • SAFETY DATA SHEET (SDS)

    Lyophilized Synthetic Peptide Powder – Research Use Only (RUO)
    Supplier: LYPHTIDE
    Contact: info@lyphtide.com
    Intended Use: Research Use Only. Not for human or veterinary use.
    SECTION 1: Identification
    Product Name: TESAMORELIN
    CAS Number: 218949-48-5
    SECTION 2: Hazard(s) Identification
    Not classified as hazardous under OSHA 29 CFR 1910.1200. Handle as a chemical of unknown toxicity.
    SECTION 3: Composition / Information on Ingredients
    Synthetic peptide ≥99%; residual salts/solvents ≤1%.
    SECTION 4: First-Aid Measures
    Inhalation: Fresh air. Skin: Wash with soap and water. Eyes: Rinse with water.
    SECTION 5: Fire-Fighting Measures
    Use water spray, CO2, dry chemical, or foam.
    SECTION 6: Accidental Release Measures
    Avoid dust. Collect with damp wipes or HEPA vacuum.
    SECTION 7: Handling and Storage
    Handle using good laboratory practices. Store at –20 °C to –80 °C.
    SECTION 8: Exposure Controls / Personal Protection
    Wear gloves, lab coat, eye protection.
    SECTION 9: Physical and Chemical Properties
    White to off-white powder; odorless.
    SECTION 10: Stability and Reactivity
    Stable under recommended conditions.
    SECTION 11: Toxicological Information
    No toxicological data available.
    SECTION 12: Ecological Information
    No data available.
    SECTION 13: Disposal Considerations
    Dispose according to applicable regulations.
    SECTION 14: Transport Information
    Not regulated as hazardous for transport.
    SECTION 15: Regulatory Information
    Prepared in accordance with OSHA 29 CFR 1910.1200.
    SECTION 16: Other Information
    Revision Date: January 2026 | Version 1.0

Documentation

Certificate of Analysis (COA) available for every batch. Third-party tested by independent laboratories.

Dimensions 1 × 1 × 2 in
Select Vial Concentration

5mg, 10mg

Shopping Cart
TESATESA
Price range: $55.00 through $85.00Select options