TESAMORELIN is a next-generation premium research compound engineered for advanced analytical, laboratory applications and is commonly researched for:
- Growth hormone–releasing hormone (GHRH) receptor signaling
- Growth hormone and IGF-1 axis research
- Visceral adipose-tissue/metabolic research
- Lipid metabolism
- Body-composition research
- Glucose metabolism and insulin-sensitivity research
- Growth hormone secretagogue/analogue research
Produced under tightly controlled conditions, each batch is precision-formulated and rigorously evaluated to ensure unmatched consistency, structural integrity, and premium performance. Each vial of TESAMORELIN is supplied as a lyophilized powder and is accompanied by a certificate of analysis verifying identity, purity, and composition. Manufactured under controlled standards to maintain consistency across laboratory research applications.
Technical Specifications
Chemical Name: Tesamorelin (TH9507), a stabilized synthetic analogue of growth hormone-releasing hormone (GHRH).
CAS No.: 218949-48-5
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL — 44 amino acids.
Molecular Formula: C₂₂₁H₃₆₆N₇₂O₆₇S
Molecular Weight: 5,136 g/mol
Product Profile
Form: Lyophilized white to off-white powder
Fill: Refer to vial label
Purity: 99% + target specification
Testing: Independently third-party verified
Quality Standard
- Exceeds 99% Purity: Analyzed via High-Performance Liquid Chromatography (HPLC) and Mass Spectrometry to ensure the removal of impurities and synthesis byproducts.
- Verified Structural Integrity: Precise sequencing and analysis ensure the compound matches the exact chemical profile required for your research protocols.
- Stable Formulation: Supplied as a lyophilized powder to ensure long-term stability and ease of reconstitution in laboratory solvents.
- Quality Assurance Guarantee: Every batch undergoes rigorous testing. We prioritize transparency and trust, providing researchers with reliable compounds for their data collection.
Storage Protocol
• Store at 2–8°C for short-term stability
• Store at −20°C for long-term preservation
• Avoid repeated freeze–thaw cycles
• Handle in accordance with standard laboratory protocols
Research Use Only
This material is supplied strictly for research, education and laboratory use only.
Not for human or animal consumption.
Not intended to diagnose, treat, cure, or prevent any condition.
Not classified as a drug, food, cosmetic, or dietary product.
For use by qualified professionals in controlled research environments only. It has not been evaluated by the FDA and is not intended to diagnose, treat, cure, or prevent any disease. All buyers must be authorized research personnel or institutions.
Terms of Sale:
By purchasing this product, you confirm that you are a qualified professional conducting lawful scientific research. LYPHTIDE and its affiliates are not liable for any misuse or mishandling of this material. The buyer assumes all responsibility for ensuring proper handling, storage, and use in compliance with applicable laws and regulations. LYPHTIDE makes no representations or warranties regarding fitness for any purpose other than research. Product use is restricted to qualified researchers in compliance with local, state, and federal law.
Disclaimer
By purchasing from LYPHTIDE, the customer acknowledges and agrees this is strictly for research purposes only.
-
SAFETY DATA SHEET (SDS)
Lyophilized Synthetic Peptide Powder – Research Use Only (RUO)
Supplier: LYPHTIDE
Contact: info@lyphtide.com
Intended Use: Research Use Only. Not for human or veterinary use.
SECTION 1: Identification
Product Name: TESAMORELIN
CAS Number: 218949-48-5
SECTION 2: Hazard(s) Identification
Not classified as hazardous under OSHA 29 CFR 1910.1200. Handle as a chemical of unknown toxicity.
SECTION 3: Composition / Information on Ingredients
Synthetic peptide ≥99%; residual salts/solvents ≤1%.
SECTION 4: First-Aid Measures
Inhalation: Fresh air. Skin: Wash with soap and water. Eyes: Rinse with water.
SECTION 5: Fire-Fighting Measures
Use water spray, CO2, dry chemical, or foam.
SECTION 6: Accidental Release Measures
Avoid dust. Collect with damp wipes or HEPA vacuum.
SECTION 7: Handling and Storage
Handle using good laboratory practices. Store at –20 °C to –80 °C.
SECTION 8: Exposure Controls / Personal Protection
Wear gloves, lab coat, eye protection.
SECTION 9: Physical and Chemical Properties
White to off-white powder; odorless.
SECTION 10: Stability and Reactivity
Stable under recommended conditions.
SECTION 11: Toxicological Information
No toxicological data available.
SECTION 12: Ecological Information
No data available.
SECTION 13: Disposal Considerations
Dispose according to applicable regulations.
SECTION 14: Transport Information
Not regulated as hazardous for transport.
SECTION 15: Regulatory Information
Prepared in accordance with OSHA 29 CFR 1910.1200.
SECTION 16: Other Information
Revision Date: January 2026 | Version 1.0







